Teriparatide | 10mg
$82.10
Teriparatide 10mg peptide is a synthetic form of the biologically active N-terminal fragment of human parathyroid hormone, consisting of the first 34 amino acids of human PTH (1–34). It is commonly studied in laboratory environments for its interaction with parathyroid hormone receptors and its role in bone metabolism, cellular signaling, and osteoblast-related research pathways.
Specifications
CAS: 52232-67-4
Molecular Formula: C181H291N55O51S2
Molecular Weight: 4118 g/mol
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Type: Human parathyroid hormone analog / PTH (1–34)
Length: 34 amino acids
Form: Lyophilized peptide powder
Purity: ≥99%
Storage: 2–8°C
The CAS number, molecular formula, molecular weight, and 34-amino-acid sequence are reported by PubChem.
Research Applications
- Commonly studied in parathyroid hormone receptor signaling research
- Investigated in laboratory models involving bone metabolism and remodeling
- Studied in research involving osteoblast differentiation and cellular signaling
- Utilized in experimental models examining PTH-mediated calcium and phosphate regulatory pathways
- Investigated in bone formation and skeletal tissue research
Related Products
“2X” Tesamorelin | Ipamorelin | 10/2mg
“2X” Tesamorelin + Ipamorelin peptide blend (10/2mg) is a dual-peptide blend commonly studied in laboratory environments for its role in growth hormone-releasing hormone (GHRH) and ghrelin receptor signaling pathways.
Specifications
Composition: Tesamorelin | Ipamorelin
Ratio: 10mg / 2mg
Form: White lyophilized powder
Purity: ≥99%
Storage: 2–8°C
Research Applications
- Commonly studied in GHRH and ghrelin receptor signaling research
- Investigated for roles in peptide-based regulatory pathways
- Utilized in laboratory studies involving endocrine-related mechanisms
Adamax | 10mg
AHK-Cu | 100mg
AOD-9604 | 5 mg
ARA 290 (Cibinetide)
BPC-157 | 10mg | 25mg
BPC-157 | TB-500 Blend
Cagrilintide | 10mg | 12.5mg
Cardiogen | 25mg
Reviews
There are no reviews yet.